LL-37

• CAS: 154947-666-7
• Molecular Formula: C₂₀₅H₃₄₀N₅₀O₅₃
• Molecular Weight: 4493,34 g/mol
• Amino Length: 37 aminoácidos
• Classification: 
• Structure: 
• Sequence: [LL-37, 37 aa]
• Synonyms: PAC-18
• NIH PubChem: View compound profile on NIH PubChem
• NIH PubMed Article:

Peptide Storage Guidelines: Best Practices for Research Stability

At Ceritide Research, we provide high-purity peptides for laboratory and scientific research. Proper storage preserves peptide integrity and supports reliable experimental results.

Storage Guidelines for Lyophilized (Powder) Peptides

• Long-Term Storage: Keep at -20°C (-4°F) or lower (ideally -80°C / -112°F) for multi-year stability.
• Short-Term Storage: Refrigerate at 2–8°C (36–46°F) for weeks to a few months. Minimize room temperature exposure.
• Best Practices: Store in airtight vials with desiccants. Allow vials to reach room temperature in a desiccator before opening. Protect from light and moisture. Aliquot to reduce freeze-thaw cycles.

Storage Guidelines for Reconstituted Peptide Solutions

Once dissolved, peptides are less stable and should be used promptly:

• Recommended Temperature: Store at 2–8°C (36–46°F) (refrigerator) for short-term use, typically up to 1–4 weeks depending on the sequence and buffer.
• Longer-Term Solution Storage: Aliquot and freeze at -20°C (-4°F) or lower. Avoid storing solutions long-term when possible.
• Best Practices: Use sterile techniques, bacteriostatic water or research-grade buffers, and minimize exposure to air and light. Prevent repeated freeze-thaw cycles.

For Research Use Only
All products from Ceritide Research are sold for research, laboratory, or analytical purposes only, and are not for human consumption. Our peptides are intended exclusively for in vitro scientific research and are not for human or veterinary use.