Tesamorelin + Ipamorelin
La mezcla Tesamorelin/Ipamorelin es una formulación de investigación de péptidos sintéticos que combina dos péptidos reguladores basados en la hormona liberadora de la hormona del crecimiento (GHRH) bien caracterizados en una única preparación analítica. Tesamorelin, un análogo de GHRH estabilizado con una secuencia lineal definida de 44 aminoácidos, e Ipamorelin, un secretagogo sintético selectivo de la hormona del crecimiento pentapeptídico, se estudian juntos en entornos de investigación para examinar las interacciones péptido-receptor, la dinámica de señalización y las relaciones comparativas estructura-función dentro de la investigación de vías endocrinas. Cada componente posee una identidad molecular documentada y propiedades fisicoquímicas establecidas, mientras que la formulación combinada se clasifica como una mezcla de multipéptidos en lugar de una entidad química única.
- Size: 10/3MG
- Form: Lyophilized Powder
- Appearance: White to off-white powder
- Weight:
- Dimensions: 2" x 2" x 2"
- Chemical Purity: >99%
- Purity & Identification Testing: HPLC & Mass Spectrometry
- Net Content Weight Testing: Milligram Weight
- Endotoxin Testing: < 0% Bacterial Endotoxins
- Regulatory Status: Solo para uso en investigación (RUO)
- Chemical Grade: Laboratory, Research y Analytical
- CAS: 218949-48-5
- Molecular Formula: C₂₂₁H₃₆₆N₇₂O₆₇S
- Molecular Weight: 5.135,9 g/mol
- Amino Length:
- Classification:
- Structure:
- Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL
- Synonyms:
- NIH PubChem: View compound profile on NIH PubChem
- NIH PubMed Article:
- CAS: 170851-70-4
- Molecular Formula: C₃₈H₄₉N₉O₅
- Molecular Weight: 711,86 g/mol
- Amino Length:
- Classification:
- Structure:
- Sequence: Aib-His-D-2Nal-D-Phe-Lys
- Synonyms:
- NIH PubChem: View compound profile on NIH PubChem
- NIH PubMed Article:
Peptide Storage Guidelines: Best Practices for Research Stability
At Ceritide Research, we provide high-purity peptides for laboratory and scientific research. Proper storage preserves peptide integrity and supports reliable experimental results.
Storage Guidelines for Lyophilized (Powder) Peptides
- Long-Term Storage: Keep at -20°C (-4°F) or lower (ideally -80°C / -112°F) for multi-year stability.
- Short-Term Storage: Refrigerate at 2–8°C (36–46°F) for weeks to a few months. Minimize room temperature exposure.
- Best Practices: Store in airtight vials with desiccants. Allow vials to reach room temperature in a desiccator before opening. Protect from light and moisture. Aliquot to reduce freeze-thaw cycles.
Storage Guidelines for Reconstituted Peptide Solutions
Once dissolved, peptides are less stable and should be used promptly:
- Recommended Temperature: Store at 2–8°C (36–46°F) (refrigerator) for short-term use, typically up to 1–4 weeks depending on the sequence and buffer.
- Longer-Term Solution Storage: Aliquot and freeze at -20°C (-4°F) or lower. Avoid storing solutions long-term when possible.
- Best Practices: Use sterile techniques, bacteriostatic water or research-grade buffers, and minimize exposure to air and light. Prevent repeated freeze-thaw cycles.
For Research Use Only
All products from Ceritide Research are sold for research, laboratory, or analytical purposes only, and are not for human consumption. Our peptides are intended exclusively for in vitro scientific research and are not for human or veterinary use.
Tesamorelin + Ipamorelin
Precio de oferta$85.00
Elige opciones
Tesamorelin + Ipamorelin
Precio de oferta$85.00