LL-37
LL-37 Research Peptide is a synthetic 37-amino-acid peptide corresponding to the mature human cathelicidin. This formulation is studied in laboratory models for its potential roles in broad-spectrum antimicrobial activity, biofilm disruption, immunomodulation, and investigation of wound healing and innate immune pathways.
Researchers value LL-37 for its physiological mechanism of electrostatic membrane interaction leading to pore formation and lysis, combined with modulation of immune cell chemotaxis and inflammatory signaling. This makes LL-37 suitable for investigating pathways involved in antimicrobial resistance, persistent infections, inflammatory balance, and tissue repair.
Ceritide Research offers LL-37 as a premium 10mg lyophilized research peptide with verified ≥99% purity confirmed by independent HPLC and mass spectrometry. Supplied in a sterile vial and ready for immediate reconstitution per your protocol, this product delivers the reliability top research labs demand.
The Purest Peptides. Period.
Research Use Only. Not for human or veterinary use.
- Size: 10MG
- Form: Lyophilized Powder
- Appearance: White to off-white powder
- Weight:
- Dimensions: 2" x 2" x 2"
- Chemical Purity: >99%
- Purity & Identification Testing: HPLC & Mass Spectrometry
- Net Content Weight Testing: Milligram Weight
- Endotoxin Testing: < 0% Bacterial Endotoxins
- Regulatory Status: Research Use Only (RUO)
- Chemical Grade: Laboratory, Research, and Analytical
- CAS: 154947-666-7
- Molecular Formula: C₂₀₅H₃₄₀N₅₀O₅₃
- Molecular Weight: 4493.34 g/mol
- Amino Length: 37 Amino Acids
- Classification:
- Structure:
- Sequence: [LL-37, 37 aa]
- Synonyms: CAP-18
- NIH PubChem: View compound profile on NIH PubChem
- NIH PubMed Article:
Peptide Storage Guidelines: Best Practices for Research Stability
At Ceritide Research, we provide high-purity peptides for laboratory and scientific research. Proper storage preserves peptide integrity and supports reliable experimental results.
Storage Guidelines for Lyophilized (Powder) Peptides
- Long-Term Storage: Keep at -20°C (-4°F) or lower (ideally -80°C / -112°F) for multi-year stability.
- Short-Term Storage: Refrigerate at 2–8°C (36–46°F) for weeks to a few months. Minimize room temperature exposure.
- Best Practices: Store in airtight vials with desiccants. Allow vials to reach room temperature in a desiccator before opening. Protect from light and moisture. Aliquot to reduce freeze-thaw cycles.
Storage Guidelines for Reconstituted Peptide Solutions
Once dissolved, peptides are less stable and should be used promptly:
- Recommended Temperature: Store at 2–8°C (36–46°F) (refrigerator) for short-term use, typically up to 1–4 weeks depending on the sequence and buffer.
- Longer-Term Solution Storage: Aliquot and freeze at -20°C (-4°F) or lower. Avoid storing solutions long-term when possible.
- Best Practices: Use sterile techniques, bacteriostatic water or research-grade buffers, and minimize exposure to air and light. Prevent repeated freeze-thaw cycles.
For Research Use Only
All products from Ceritide Research are sold for research, laboratory, or analytical purposes only, and are not for human consumption. Our peptides are intended exclusively for in vitro scientific research and are not for human or veterinary use.
Choose options