Tesamorelin + Ipamorelin
Tesamorelin + Ipamorelin Blend is a synthetic dual-peptide research formulation combining the 44-amino-acid GHRH analog Tesamorelin with the pentapeptide ghrelin receptor agonist Ipamorelin. This synergistic blend is studied in laboratory models for its potential roles in amplifying pulsatile endogenous GH secretion, IGF-1 modulation, lipolysis, and metabolic regulation. Characterized by complementary mechanisms, the blend is widely referenced in scientific literature for peptide structure–function analysis, pituitary signaling, and investigations into age-related somatotropic changes, body composition, and recovery pathways.
Researchers value Tesamorelin + Ipamorelin Blend for its coordinated action: Tesamorelin’s GHRH receptor activation paired with Ipamorelin’s selective ghrelin receptor agonism, resulting in enhanced natural GH pulses while minimizing side effects on cortisol, prolactin, or appetite. This dual approach provides a powerful tool for studying GH/IGF-1 axis synergy in controlled experimental settings.
Ceritide Research offers Tesamorelin + Ipamorelin Blend as a premium 10mg/3mg lyophilized research peptide with verified ≥99% purity confirmed by independent HPLC and mass spectrometry. Supplied in a sterile vial and ready for immediate reconstitution per your protocol, this product delivers the reliability top research labs demand.
The Purest Peptides. Period.
Research Use Only. Not for human or veterinary use.
- Size: 10/3MG
- Form: Lyophilized Powder
- Appearance: White to off-white powder
- Weight:
- Dimensions: 2" x 2" x 2"
- Chemical Purity: >99%
- Purity & Identification Testing: HPLC & Mass Spectrometry
- Net Content Weight Testing: Milligram Weight
- Endotoxin Testing: < 0% Bacterial Endotoxins
- Regulatory Status: Research Use Only (RUO)
- Chemical Grade: Laboratory, Research, and Analytical
- CAS: 218949-48-5
- Molecular Formula: C₂₂₁H₃₆₆N₇₂O₆₇S
- Molecular Weight: 5,135.9 g/mol
- Amino Length:
- Classification:
- Structure:
- Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL
- Synonyms:
- NIH PubChem: View compound profile on NIH PubChem
- NIH PubMed Article:
- CAS: 170851-70-4
- Molecular Formula: C₃₈H₄₉N₉O₅
- Molecular Weight: 711.86 g/mol
- Amino Length:
- Classification:
- Structure:
- Sequence: Aib-His-D-2Nal-D-Phe-Lys
- Synonyms:
- NIH PubChem: View compound profile on NIH PubChem
- NIH PubMed Article:
Peptide Storage Guidelines: Best Practices for Research Stability
At Ceritide Research, we provide high-purity peptides for laboratory and scientific research. Proper storage preserves peptide integrity and supports reliable experimental results.
Storage Guidelines for Lyophilized (Powder) Peptides
- Long-Term Storage: Keep at -20°C (-4°F) or lower (ideally -80°C / -112°F) for multi-year stability.
- Short-Term Storage: Refrigerate at 2–8°C (36–46°F) for weeks to a few months. Minimize room temperature exposure.
- Best Practices: Store in airtight vials with desiccants. Allow vials to reach room temperature in a desiccator before opening. Protect from light and moisture. Aliquot to reduce freeze-thaw cycles.
Storage Guidelines for Reconstituted Peptide Solutions
Once dissolved, peptides are less stable and should be used promptly:
- Recommended Temperature: Store at 2–8°C (36–46°F) (refrigerator) for short-term use, typically up to 1–4 weeks depending on the sequence and buffer.
- Longer-Term Solution Storage: Aliquot and freeze at -20°C (-4°F) or lower. Avoid storing solutions long-term when possible.
- Best Practices: Use sterile techniques, bacteriostatic water or research-grade buffers, and minimize exposure to air and light. Prevent repeated freeze-thaw cycles.
For Research Use Only
All products from Ceritide Research are sold for research, laboratory, or analytical purposes only, and are not for human consumption. Our peptides are intended exclusively for in vitro scientific research and are not for human or veterinary use.
Choose options